Web Analysis for Lighttacklefishingpanamacity - lighttacklefishingpanamacity.com
Inshore Charters Panama City Panama City Beach is an inshore fishing charter and fishing guide service, in Panama City, Panama City Beach Specializing in Speckled Sea Trout, Red fish, and Flounder
3.90
Rating by CuteStat
lighttacklefishingpanamacity.com is 5 years 1 month old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, lighttacklefishingpanamacity.com is SAFE to browse.
PageSpeed Score
56
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 993,000 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 1 |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 6 |
Google Adsense: | Not Applicable | Google Analytics: | UA-30345472-2 |
Websites Hosted on Same IP (i.e. 66.96.147.160)
Sara Web Popularity – SEO Blog, Inbound Marketing, Digital Marketing
- sarawebpopularity.com
1,550,594
$
720.00
Beijing Discovery Tours Home
- beijingdiscoverytours.com
Beijing Discovery Tours is a reliable American & Chinese owned Beijing tour and China tour company in business since 2007.
Not Applicable
$
8.95
Free MP3 music search and download. Top artists, songs and hit music f
- veax.org
Free MP3 music search and download. Top artists, songs and hit music free for download.
862,998
$
720.00
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Tue, 02 Apr 2019 00:07:37 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 32923
Connection: keep-alive
Keep-Alive: timeout=30
Server: Apache/2
Last-Modified: Mon, 01 Apr 2019 00:30:08 GMT
ETag: "809b-5856d1f65681e"
Cache-Control: max-age=3600
Expires: Tue, 02 Apr 2019 00:25:26 GMT
Accept-Ranges: bytes
Age: 2530
Date: Tue, 02 Apr 2019 00:07:37 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 32923
Connection: keep-alive
Keep-Alive: timeout=30
Server: Apache/2
Last-Modified: Mon, 01 Apr 2019 00:30:08 GMT
ETag: "809b-5856d1f65681e"
Cache-Control: max-age=3600
Expires: Tue, 02 Apr 2019 00:25:26 GMT
Accept-Ranges: bytes
Age: 2530
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.ipage.com | 66.96.142.116 | United States of America | |
ns2.ipage.com | 65.254.254.151 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
lighttacklefishingpanamacity.com | A | 3599 |
IP: 66.96.147.160 |
lighttacklefishingpanamacity.com | NS | 3600 |
Target: ns1.ipage.com |
lighttacklefishingpanamacity.com | NS | 3600 |
Target: ns2.ipage.com |
lighttacklefishingpanamacity.com | SOA | 3598 |
MNAME: ns1.ipage.com RNAME: dnsadmin.ipage.com Serial: 2019033149 Refresh: 10800 Retry: 3600 Expire: 604800 Minimum TTL: 3600 |
lighttacklefishingpanamacity.com | MX | 3600 |
Priority: 30 Target: mx.lighttacklefishingpanamacity.com |
lighttacklefishingpanamacity.com | TXT | 3600 |
TXT: v=spf1 ip4:66.96.128.0/18 ?all |
Full WHOIS Lookup
Domain Name: LIGHTTACKLEFISHINGPANAMACITY.COM
Registry Domain ID: 2375120167_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-03-31T16:17:55Z
Creation Date: 2019-03-31T15:54:31Z
Registry Expiry Date: 2021-03-31T15:54:31Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.IPAGE.COM
Name Server: NS2.IPAGE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-04-02T00:07:35Z
Registry Domain ID: 2375120167_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-03-31T16:17:55Z
Creation Date: 2019-03-31T15:54:31Z
Registry Expiry Date: 2021-03-31T15:54:31Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.IPAGE.COM
Name Server: NS2.IPAGE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-04-02T00:07:35Z